Search results
Filter
Filetype
Your search for "site credit fc Visitez le site Buyfc26coins.com Site unanimement reconnu pour les FC 26 coins.hL57" yielded 39328 hits
Association Between the PRIMARY Score at Staging Prostate-specific Membrane Antigen Positron Emission Tomography and Overall Survival Among Patients with Newly Diagnosed Prostate Cancer : Findings from the International, Multicenter PROMISE Registry
The PRIMARY score was implemented in Prostate Cancer Molecular Imaging Standardized Evaluation (PROMISE) version 2 to improve accuracy for the diagnosis of clinically significant prostate cancer using prostate-specific membrane antigen (PSMA) positron emission tomography (PET). We reviewed overall survival (OS) for patients who underwent PSMA PET for initial staging to evaluate the prognostic valu
Plant conservation hologenomics : integrating population genomics with mycobiome assessments for protected orchid species
ClusterVAP : study protocol for multicentre proteomic endotyping of ventilator-associated pneumonia
INTRODUCTION: Ventilator-associated pneumonia (VAP) is the most frequent healthcare-associated infection in intensive care units and is associated with high morbidity and mortality. Current diagnostic criteria lack specificity, leading to misclassification and unnecessary antibiotic use. Identifying patient subgroups with a common pathophysiological basis (pneumoclusters) may distinguish true VAP
Emotion-Driven Distortions in Temporal Memory: The Role of Visual Exploration during Encoding
Temporal information in episodic memory reflects how experiences are encoded rather than objective elapsed time, giving rise to systematic distortions. These are particularly evident in emotional contexts, consistent with emotion-related biases in attention. The present study investigated whether emotion-driven distortions in remembered temporal distance were explained by encoding-related attentio
Reconstruction of electrical resistivity tomography (ERT) data using different base measurements
Electrical resistivity tomography (ERT) is a widely used technique for imaging subsurface resistivity distributions, but conventional data acquisition strategies face trade-offs between resolution, efficiency, and data quality. Comprehensive datasets that maximize subsurface information are impractical to measure directly, motivating the development of ERT data reconstruction approaches that can g
JNK-regulated phosphoproteome links synaptic and metabolic pathways to mood regulation
c-Jun N-terminal kinases (JNKs) are implicated in both neurodegeneration and mood regulation, including anxiety and depressive-like behaviours. Yet the consequences of JNK inhibition in vivo on protein phosphorylation in the brain remain largely unknown. This study aimed to (1) determine how chronic JNK inhibition altered proteome-wide phosphorylation in hippocampus and nucleus accumbens, regions
Late Gadolinium Enhancement in Repaired Tetralogy of Fallot May Overestimate Right Ventricular Myocardial Fibrosis
Cardiac magnetic resonance (CMR) with late gadolinium enhancement (LGE) imaging shows myocardial fibrosis and is associated with outcome in repaired Tetralogy of Fallot (rToF). However, patients with rToF have surgical material implanted, also appearing bright in LGE images. Therefore, right ventricular myocardial fibrosis could be overestimated or falsely diagnosed, which may affect prognostic va
Movement in the Rights Direction : An Ethnography of the UN Human Rights Committee
What takes place during the monitoring cycles of UN treaty bodies, and what impact do these cycles have both locally and globally? Movement in the Rights Direction explores these questions through the lens of the UN Human Rights Committee, the treaty body responsible for overseeing state compliance with the International Covenant on Civil and Political Rights (ICCPR), often considered the UN’s mos
Mechanisms of Body Alignment in a Diurnal Songbird Migrant
Animals align their body in relation to different environmental cues, including spontaneous directional responses relative to the geomagnetic field known as magnetic body alignment. The biological significance of this behavior, however, remains undetermined for most taxa. In previous studies, migratory songbirds aligned their body with the cardinal directions of the geomagnetic field and their mig
Role of the Ser/Thr protein kinase AfsK in Streptomyces venezuelae
Klibbiga grenar Föreställ dig, en stilla promenad i lätt vårregn. Känn doften av fuktig jord. Jorddoften kommer från jordlevande bakterierna som kallas Streptomyceter. Då dessa bakterier utgör en av våra viktigaste källor till antibiotika är de särskilt intressanta att studera. Men hur växer de egentligen? I stället för att föröka sig via celldelning bildar dessa bakterier stora nätverk, likt rötStreptomycetes grow as filamentous cells called hyphae. These cells elongate using a polar method of growth where the cell wall synthesis is restricted to the hyphal tips. It has been proved that the protein DivIVA directs the cell wall assembly to the poles and initiate branch formation along the lateral cell wall. Observations of DivIVA shows that it is regulated by AfsK, a Ser/Thr protein kinas
A new polymorphism in the coding region of exon four in HSD17B2 in relation to risk of sporadic and hereditary breast cancer
In situ synthesis of oestrogens is of great importance in the development and progression of breast cancer. 17β-hydroxysteroid dehydrogenase (17HSD) type 2 catalyses oxidation from oestradiol to oestrone, and thereby protects the breast epithelial cells from oestradiol. Low expression of 17HSD type 2 has been associated with decreased survival in breast cancer, but no studies have investigated the
Exhibition in Lund, Sweden: Following the fish : films, drawings and full-scale prototypes developed through a workshop-based artistic research project
Following the Fish—an artistic research project exploring architecture, migration and collective practice through workshop-based methodologies—was presented in 2024 as part of the exhibition UnFold: Exploring Artistic Directions in Architectural Research at Lund University.The project was developed through a series of workshops across Barcelona, Lund and Venice, engaging with the spatial and socia
Dissociation between short-term increased graft survival and long-term functional improvements in Parkinsonian rats overexpressing glial cell line-derived neurotrophic factor.
Autophosphorylation suppresses, whereas kinase inhibition augments, the translocation of PKCa in response to diacylglycerol.
We have seen that protein kinase Calpha (PKCalpha) is transiently translocated to the plasma membrane by carbachol stimulation of neuroblastoma cells. This is induced by the Ca2+ increase, and PKCalpha does not respond to diacylglycerol (DAG). The unresponsiveness is dependent on structures in the catalytic domain of PKCalpha. This study was designed to investigate if and how the kinase activity a
Acidification of sandy grasslands - consequences for plant diversity
Questions: (1) Does soil acidification in calcareous sandy grasslands lead to loss of plant diversity? (2) What is the relationship between the soil content of lime and the plant availability of mineral nitrogen (N) and phosphorus (P) in sandy grasslands? Location: Sandy glaciofluvial deposits in south-eastern Sweden covered by xeric sand calcareous grasslands (EU habitat directive 6120). Methods:
Differentiation of the RN33B Cell Line into Forebrain Projection Neurons after Transplantation into the Neonatal Rat Brain.
The rat neural cell line RN33B has a remarkable ability to undergo region-specific neuronal differentiation after transplantation into the CNS. To further study its neurogenic properties in vivo, we used a recombinant lentiviral vector to genetically label the cells with the Green Fluorescent Protein (GFP) gene before implantation into the striatum/cortex, hippocampus, or mesencephalon of newborn
Is the association between Helicobacter pylori and gastric cancer confined to CagA-positive strains?
Background. Infection with Helicobacter pylori is associated with an increased risk of gastric cancer. Several studies have indicated that the association differs with strain type. We aimed to find out if infection with strains lacking the virulence factor CagA is linked to gastric cancer risk. Materials and methods. In a hospital-based case-control study, we collected sera from 100 case patients
Incorporation of antimicrobial compounds in mesoporous silica film monolith
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve
