Search results

The large-scale mass mobilizations and colossal demonstrations of the last decade have shown that digital and social media platforms, globally, now play significant roles in early formation and further facilitation of activist movements, interested in progressive causes and societal changes. However, the repercussions of the very same events have also clearly shown the shortcomings of mediatized a

The osteopontin-derived peptide FOL-005 stimulates hair growth. Using ligand-receptor glyco-capture technology we identified neuropilin-1 (NRP-1), a known co-receptor for vascular endothelial growth factor (VEGF) receptors, as the most probable receptor for FOL-005 and the more stable analogue FOL-026. X-ray diffraction and microscale thermophoresis analysis revealed that FOL-026 shares binding si

Accurate and reliable estimation of actual evapotranspiration (AET) is essential for various hydrological studies, including drought prediction, water resource management, and the analysis of atmospheric–terrestrial carbon exchanges. Gridded AET products offer potential for application in ungauged areas, but their uncertainties may be significant, making it difficult to identify the best products

Lead-free layered double perovskite nanocrystals (NCs), i.e., Cs4M(II)M(III)2Cl12, have recently attracted increasing attention for potential optoelectronic applications due to their low toxicity, direct bandgap nature, and high structural stability. However, the low photoluminescence quantum yield (PLQY, <1%) or even no observed emissions at room temperature have severely blocked the further deve

To help meet emission standards, hydrogen sulfide (H2S) from geothermal production may be injected back into the subsurface, where basalt offers, in theory, the capacity to mineralize H2S into pyrite. Ensuring the viability of this pollution mitigation technology requires information on how much H2S is mineralized, at what rate and where. To date, monitoring efforts of field-scale H2S reinjection

Flera platser utmed den skånska kusten har idag problem med stranderosion som innebär att havet äter sig inåt land så att stränder och kustlandskap försvinner. När havet stiger förväntas stranderosionen att öka och även kust sträckor som idag inte har problem kan komma att drabbas. Då kustlinjen rör sig inåt land hotas bebyggelse, infra struktur och naturområden, samtidigt som översvämningsrisken Beach erosion is expected to increase as the sea level rises during the coming decades. A retreating coastline threat ens infrastructure, settlements, nature habitats, and at the same time increases the flood risk in low-lying areas. On the Swedish south coast, beach erosion is a problem at present likely to increase due to the sea level rise. For main taining the beaches and protecting the hinter

Understanding the relation between enzyme domain structure and catalytic activity is crucial for optimal engineering of novel enzymes for lignocellulose bioconversion. Xylanases with varying specificities are commonly used to valorise the hemicellulose arabinoxylan (AX), yet characterization of specific arabinoxylanases remain limited. Two homologous GH5_34 arabinoxylanases, HhXyn5A and CtXyn5A, i

We present a new instrument, "Boreas", a cryogen-free methane (CH4) preconcentration system coupled to a dual-laser spectrometer for making simultaneous measurements of δ13C(CH4) and δ2H(CH4) in ambient air. Excluding isotope ratio scale uncertainty, we estimate a typical standard measurement uncertainty for an ambient air sample of 0.07‰ for δ13C(CH4) and 0.9‰ for δ2H(CH4), which are the lowest r

We have seen that protein kinase Calpha (PKCalpha) is transiently translocated to the plasma membrane by carbachol stimulation of neuroblastoma cells. This is induced by the Ca2+ increase, and PKCalpha does not respond to diacylglycerol (DAG). The unresponsiveness is dependent on structures in the catalytic domain of PKCalpha. This study was designed to investigate if and how the kinase activity a

Questions: (1) Does soil acidification in calcareous sandy grasslands lead to loss of plant diversity? (2) What is the relationship between the soil content of lime and the plant availability of mineral nitrogen (N) and phosphorus (P) in sandy grasslands? Location: Sandy glaciofluvial deposits in south-eastern Sweden covered by xeric sand calcareous grasslands (EU habitat directive 6120). Methods:

The rat neural cell line RN33B has a remarkable ability to undergo region-specific neuronal differentiation after transplantation into the CNS. To further study its neurogenic properties in vivo, we used a recombinant lentiviral vector to genetically label the cells with the Green Fluorescent Protein (GFP) gene before implantation into the striatum/cortex, hippocampus, or mesencephalon of newborn

Background. Infection with Helicobacter pylori is associated with an increased risk of gastric cancer. Several studies have indicated that the association differs with strain type. We aimed to find out if infection with strains lacking the virulence factor CagA is linked to gastric cancer risk. Materials and methods. In a hospital-based case-control study, we collected sera from 100 case patients

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve

Aim: This paper describes the quality assurance (QA) work performed in the Swedish multicenter ARTSCAN (Accelerated RadioTherapy of Squamous cell CArcinomas in the head and Neck) trial to guarantee high quality in a multicenter study which involved modern radiotherapy such as 3DCRT or IMRT. Materials and methods: The study was closed in June 2006 with 750 randomised patients. Radiation therapy-rel

The aim of the present study was to investigate seasonal and spatial patterns of soil oxygen consumption, nitrification, denitrification and fluxes of dissolved inorganic nitrogen (DIN) in a tidal salt marsh of the Lagoon of Venice, Italy. In the salt marsh, intact soil cores including overlying water were collected monthly at high tide from April to October in salt marsh creeks and in areas cover

Recombinant FVIIa has been developed for treatment of bleedings in hemophilia patients with inhibitors, and has been found to induce hemostasis even during major surgery such as major orthopedic surgery. Recombinant FVIIa is being produced in BHK cell cultures and has been shown to be very similar to plasma-derived FVIIa. The use of rFVIIa in hemophilia treatment is a new concept of treatment and